PDB entry 3pqs

View 3pqs on RCSB PDB site
Description: The crystal structures of porcine pathogen ApH87_TbpB
Class: lipid binding protein
Keywords: lipoprotein, transferrin receptor, iron acquisition, vaccine candidate, Beta barrel, Transferrin Binding, Transferrin, Outermembrane, LIPID BINDING PROTEIN
Deposited on 2010-11-26, released 2011-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transferrin-binding protein
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Gene: tfbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44167 (Start-520)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d3pqsa1, d3pqsa2, d3pqsa3, d3pqsa4
  • Heterogens: GOL, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pqsA (A:)
    fdlddvqpnkavepektkvnytdeetqkrkkeeldklmepalgyvtkipvnipsvrktei
    seidtvtdeslslvpnedklrtianenygsvvtksgsntmnfvrsgytidvvhyglrdkg
    yvyykgvhpskelpkgniivyqgewdftsnadldakrpnynpefngygagqrvgvtsada
    kertyiskfnidfsnkklngqlltktkenqeklrytveanisgnrfrgkatatdktdpil
    gkdsehlegglygpkseelagkfvahdkslfavfsgkrgndvletvkiidaskidlttfe
    sselnnfgnanvliidgqkidlagadfknrktvdingktmvaiaccsnleymkfgqlwqk
    egeqtkdnslflqgertatdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsef
    dvnfgdkkvsgklfdkggivpvfminadikgngftgtanttdtgfaldsgssqhgnavfs
    dikvnggfygptagelggqfhhksdngsvgavfgakrqiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqsA (A:)
    kvnytdeetqkrkkeeldklmepalgyvtkipvnipsvrkteiseidtvtdeslslvpne
    dklrtianenygsvvtksgsntmnfvrsgytidvvhyglrdkgyvyykgvhpskelpkgn
    iivyqgewdftsnadldakrpnynpefngygagqrvgvtsadakertyiskfnidfsnkk
    lngqlltktkenqeklrytveanisgnrfrgkatatdktdpilgkdsehlegglygpkse
    elagkfvahdkslfavfsgkrgndvletvkiidaskidlttfesselnnfgnanvliidg
    qkidlagadfknrktvdingktmvaiaccsnleymkfgqlwqkegeqtkdnslflqgert
    atdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkg
    givpvfminadikgngftgtanttdtgfaldsgssqhgnavfsdikvnggfygptagelg
    gqfhhksdngsvgavfgakrqiek