PDB entry 3pqd

View 3pqd on RCSB PDB site
Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis complexed with FBP and NAD+
Class: oxidoreductase
Keywords: Lactate dehydrogenase, FBP, NAD+, OXIDOREDUCTASE
Deposited on 2010-11-26, released 2012-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqda1, d3pqda2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqdb1, d3pqdb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqdc1, d3pqdc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqdd1, d3pqdd2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqde1, d3pqde2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqdf1, d3pqdf2
  • Chain 'G':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqdg1, d3pqdg2
  • Chain 'H':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqdh1, d3pqdh2
  • Heterogens: FBP, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pqdA (A:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdA (A:)
    khvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvk
    tsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvat
    npvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdte
    lpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslar
    itkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhs
    agvlknilkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pqdB (B:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdB (B:)
    hvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvkt
    sygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvatn
    pvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtel
    pvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslari
    tkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsa
    gvlknilkphfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pqdC (C:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdC (C:)
    hvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvkt
    sygtyedckdadivcicagrlelveknlkifkgivsevmasgfdgiflvatnpvdiltya
    twkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtelpvwshanv
    ggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslaritkailhne
    nsiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilk
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pqdD (D:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdD (D:)
    hvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvkt
    sygtyedckdadivcicalelveknlkifkgivsevmasgfdgiflvatnpvdiltyatw
    kfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtelpvwshanvgg
    vpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslaritkailhnens
    iltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkph
    f
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pqdE (E:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdE (E:)
    hvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvkt
    sygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvatn
    pvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtel
    pvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslari
    tkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsa
    gvlknilkphf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3pqdF (F:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdF (F:)
    hvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvkt
    sygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvatn
    pvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtel
    pvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslari
    tkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsa
    gvlknilkphf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3pqdG (G:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdG (G:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaelveknlkifkgivsevmasgfdgiflvatnpvdiltyat
    wkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtelpvwshanvg
    gvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslaritkailhnen
    siltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkp
    hf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3pqdH (H:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqdH (H:)
    khvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvk
    tsygtyedckdadivcicaelveknlkifkgivsevmasgfdgiflvatnpvdiltyatw
    kfsglpkervigsgttldsarfrfmlseyfgaapqnvhahiigehgdtelpvwshanvgg
    vpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslaritkailhnens
    iltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkph
    f