PDB entry 3ppc

View 3ppc on RCSB PDB site
Description: Crystal structure of the Candida albicans methionine synthase by surface entropy reduction, tyrosine variant with zinc
Class: Transferase
Keywords: cobalamin-independent, Surface entropy reduction, Transferase
Deposited on 2010-11-24, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Candida albicans [TaxId:5476]
    Gene: CaO19.10083, CaO19.2551, MET6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82610 (22-788)
      • expression tag (20-21)
      • engineered mutation (124-125)
    Domains in SCOPe 2.07: d3ppca1, d3ppca2, d3ppca3
  • Chain 'B':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Candida albicans [TaxId:5476]
    Gene: CaO19.10083, CaO19.2551, MET6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82610 (22-788)
      • expression tag (21)
      • engineered mutation (124-125)
    Domains in SCOPe 2.07: d3ppcb1, d3ppcb2, d3ppcb3
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ppcA (A:)
    mhhhhhhssgvdlgtenlyfqsmvqssvlgfpriggqrelkkiteaywsgkatveellak
    gkelrehnwklqqkagvdiipsndfsyydqvldlsllfnaiperytkfdlapidvlfamg
    rglqyyatytqaavdvtalemvkwfdsnyhyvrptfshstefklntaagikpvdefneak
    algvqtrpvilgpvsylylgkadkdsldlepisllpkilpvykellqklkeagaeqvqid
    epvlvldlpeavqskfkeaydalvgadvpelilttyfgdvrpnlkaienlpvagfhfdfv
    rvpeqldevasilkdgqtlsagvvdgrniwktdfakasavvqkaiekvgkdkvvvatsss
    llhtpvdlesetkldavikdwfsfatqkldevvviaknvsgedvskqleanaasikarse
    ssitndpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirin
    rnkfakgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfaf
    ttngwvqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsf
    prddvsgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaa
    qsfrvatsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnh
    iglglfdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmve
    aakefraky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ppcA (A:)
    qsmvqssvlgfpriggqrelkkiteaywsgkatveellakgkelrehnwklqqkagvdii
    psndfsyydqvldlsllfnaiperytkfdlapidvlfamgrglqyyattalemvkwfdsn
    yhyvrptfshstefklntaagikpvdefneakalgvqtrpvilgpvsylylgkadkdsld
    lepisllpkilpvykellqklkeagaeqvqidepvlvldlpeavqskfkeaydalvgadv
    pelilttyfgdvrpnlkaienlpvagfhfdfvrvpeqldevasilkdgqtlsagvvdgrn
    iwktdfakasavvqkaiekvgkdkvvvatsssllhtpvdlesetkldavikdwfsfatqk
    ldevvviaknvsgedvskqleanaasikarsessitndpkvqerltinealatrkaafpe
    rlteqkakynlplfptttigsfpqirinrnkfakgqitaeeyeafinkeietvvrfqeei
    gldvlvhgeperndmvqyfgeqlngfafttngwvqsygsryvrppiivgdvsrpkamtvk
    esvyaqsitskpmkgmltgpvtilrwsfprddvsgkiqalqlglalrdevndlegagitv
    iqvdepaireglplragkersdylnwaaqsfrvatsgvenstqihshfcysdldpnhika
    ldadvvsiefspnyiqefseypnhiglglfdihspripskqefvsrieeilkvypaskfw
    vnpdcglktrgwpevkesltnmveaakefraky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ppcB (B:)
    mhhhhhhssgvdlgtenlyfqsmvqssvlgfpriggqrelkkiteaywsgkatveellak
    gkelrehnwklqqkagvdiipsndfsyydqvldlsllfnaiperytkfdlapidvlfamg
    rglqyyatytqaavdvtalemvkwfdsnyhyvrptfshstefklntaagikpvdefneak
    algvqtrpvilgpvsylylgkadkdsldlepisllpkilpvykellqklkeagaeqvqid
    epvlvldlpeavqskfkeaydalvgadvpelilttyfgdvrpnlkaienlpvagfhfdfv
    rvpeqldevasilkdgqtlsagvvdgrniwktdfakasavvqkaiekvgkdkvvvatsss
    llhtpvdlesetkldavikdwfsfatqkldevvviaknvsgedvskqleanaasikarse
    ssitndpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirin
    rnkfakgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfaf
    ttngwvqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsf
    prddvsgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaa
    qsfrvatsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnh
    iglglfdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmve
    aakefraky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ppcB (B:)
    smvqssvlgfpriggqrelkkiteaywsgkatveellakgkelrehnwklqqkagvdiip
    sndfsyydqvldlsllfnaiperytkfdlapidvlfamgrglqyytalemvkwfdsnyhy
    vrptfshstefklntaagikpvdefneakalgvqtrpvilgpvsylylgkadkdsldlep
    isllpkilpvykellqklkeagaeqvqidepvlvldlpeavqskfkeaydalvgadvpel
    ilttyfgdvrpnlkaienlpvagfhfdfvrvpeqldevasilkdgqtlsagvvdgrniwk
    tdfakasavvqkaiekvgkdkvvvatsssllhtpvdlesetkldavikdwfsfatqklde
    vvviaknvsgedvskqleanaasikarsessitndpkvqerlttinealatrkaafperl
    teqkakynlplfptttigsfpqtaeeyeafinkeietvvrfqeeigldvlvhgeperndm
    vqyfgeqlngfafttngwvqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkg
    mltgpvtilrwsfprddvsgkiqalqlglalrdevndlegagitviqvdepaireglplr
    agkersdylnwaaqsfrvatsgvenstqihshfcysdldpnhikaldadvvsiefsiqef
    seypnhiglglfdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkes
    ltnmveaakefraky