PDB entry 3pp3

View 3pp3 on RCSB PDB site
Description: Epitope characterization and crystal structure of GA101 provide insights into the molecular basis for the type I / type II distinction of anti- CD20 antibodies
Class: immune system
Keywords: antibody Fab-fragment Ig-domain, antibody, CD20, IMMUNE SYSTEM
Deposited on 2010-11-24, released 2011-04-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: GA101 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PP3 (0-End)
  • Chain 'I':
    Compound: GA101 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PP3 (0-End)
  • Chain 'K':
    Compound: GA101 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PP3 (0-218)
    Domains in SCOPe 2.03: d3pp3k1, d3pp3k2
  • Chain 'L':
    Compound: GA101 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PP3 (0-218)
    Domains in SCOPe 2.03: d3pp3l1, d3pp3l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pp3K (K:)
    divmtqtplslpvtpgepasiscrssksllhsngitylywylqkpgqspqlliyqmsnlv
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycaqnlelpytfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pp3L (L:)
    divmtqtplslpvtpgepasiscrssksllhsngitylywylqkpgqspqlliyqmsnlv
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycaqnlelpytfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec