PDB entry 3pp1

View 3pp1 on RCSB PDB site
Description: Crystal Structure of the Human Mitogen-activated protein kinase kinase 1 (MEK 1) in complex with ligand and MgATP
Class: transferase/transferase inhibitor
Keywords: Kinase domain, Kinase, ATP binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-11-23, released 2011-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, Mapk/erk kinase 1, MEK1, PRKMK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (1-321)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d3pp1a_
  • Heterogens: ATP, MG, IZG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pp1A (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
    gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
    ikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pp1A (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfpmaifelldyivnepppklpsgvfs
    lefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln