PDB entry 3pp0

View 3pp0 on RCSB PDB site
Description: Crystal Structure of the Kinase domain of Human HER2 (erbB2).
Class: transferase/transferase inhibitor
Keywords: KINASE DOMAIN, ANTI-ONCOGENE, ATP-BINDING, CELL CYCLE, DISEASE MUTATION, GLYCOPROTEIN, MEMBRANE, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, RECEPTOR, SECRETED, TRANSFERASE, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, TYROSINE KINASE INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-11-23, released 2011-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor tyrosine-protein kinase erbB-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB2, HER2, MLN19, NEU, NGL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04626 (4-End)
      • engineered mutation (4)
      • engineered mutation (9-10)
    Domains in SCOPe 2.05: d3pp0a_
  • Chain 'B':
    Compound: Receptor tyrosine-protein kinase erbB-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB2, HER2, MLN19, NEU, NGL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04626 (4-307)
      • engineered mutation (4)
      • engineered mutation (9-10)
    Domains in SCOPe 2.05: d3pp0b_
  • Heterogens: 03Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pp0A (A:)
    msgaapnqallrilketelrkvkvlgsgafgtvykgiwipdgenvkipvaikvlrentsp
    kankeildeayvmagvgspyvsrllgicltstvqlvtqlmpygclldhvrenrgrlgsqd
    llnwcmqiakgmsyledvrlvhrdlaarnvlvkspnhvkitdfglarlldideteyhadg
    gkvpikwmalesilrrrfthqsdvwsygvtvwelmtfgakpydgipareipdllekgerl
    pqppictidvymimvkcwmidsecrprfrelvsefsrmardpqrfvviqnedlgpaspld
    stfyrslledddmgdlvdaeeylvpqqgaaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pp0A (A:)
    apnqallrilketelrkvkvlgsgafgtvykgiwipdgenvkipvaikvlrentspkank
    eildeayvmagvgspyvsrllgicltstvqlvtqlmpygclldhvrenrgrlgsqdllnw
    cmqiakgmsyledvrlvhrdlaarnvlvkspnhvkitdfglarlldideteyhagkvpik
    wmalesilrrrfthqsdvwsygvtvwelmtfgakpydgipareipdllekgerlpqppic
    tidvymimvkcwmidsecrprfrelvsefsrmardpqrfvviqned
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pp0B (B:)
    msgaapnqallrilketelrkvkvlgsgafgtvykgiwipdgenvkipvaikvlrentsp
    kankeildeayvmagvgspyvsrllgicltstvqlvtqlmpygclldhvrenrgrlgsqd
    llnwcmqiakgmsyledvrlvhrdlaarnvlvkspnhvkitdfglarlldideteyhadg
    gkvpikwmalesilrrrfthqsdvwsygvtvwelmtfgakpydgipareipdllekgerl
    pqppictidvymimvkcwmidsecrprfrelvsefsrmardpqrfvviqnedlgpaspld
    stfyrslledddmgdlvdaeeylvpqqgaaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pp0B (B:)
    apnqallrilketelrkvkvlgsgafgtvykgiwipdgenvkipvaikvlrentspkank
    eildeayvmagvgspyvsrllgicltstvqlvtqlmpygclldhvrenrgrlgsqdllnw
    cmqiakgmsyledvrlvhrdlaarnvlvkspnhvkitdfglarlldideteyhagkvpik
    wmalesilrrrfthqsdvwsygvtvwelmtfgakpydgipareipdllekgerlpqppic
    tidvymimvkcwmidsecrprfrelvsefsrmardpqrfvviqnepldstfyrsll