PDB entry 3poz

View 3poz on RCSB PDB site
Description: EGFR Kinase domain complexed with tak-285
Class: transferase/transferase inhibitor
Keywords: KINASE DOMAIN, ANTI-ONCOGENE, ATP-BINDING, CELL CYCLE, DISEASE MUTATION, GLYCOPROTEIN, MEMBRANE, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, RECEPTOR, SECRETED, TRANSFERASE, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-11-23, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.22
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3poza_
  • Heterogens: SO4, 03P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pozA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pozA (A:)
    qallrilketefkkikvlgsgafgtvykglwipvkipvaikelankeildeayvmasvdn
    phvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyledr
    rlvhrdlaarnvlvktpqhvkitdfglakllgaeekkvpikwmalesilhriythqsdvw
    sygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsr
    pkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdvvdadeyl