PDB entry 3pom

View 3pom on RCSB PDB site
Description: Crystal Structure of the Unliganded Retinoblastoma Protein Pocket Domain
Class: cell cycle
Keywords: Cyclin Fold, Tumor Suppressor Protein, CELL CYCLE
Deposited on 2010-11-23, released 2011-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoblastoma-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06400 (Start-200)
      • linker (201-203)
    • Uniprot P06400 (207-347)
    Domains in SCOPe 2.08: d3poma1, d3poma2
  • Chain 'B':
    Compound: Retinoblastoma-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06400 (Start-200)
      • linker (201-202)
    • Uniprot P06400 (Start-347)
    Domains in SCOPe 2.08: d3pomb1, d3pomb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pomA (A:)
    gefntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgq
    gcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvma
    tysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehr
    imeslawlsdsplfdlikqsklvprgskstslslfykkvyrlaylrlntlcerllsehpe
    lehiiwtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphav
    qetfkrvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pomA (A:)
    qqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcveig
    sqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatysrst
    sqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimesla
    wlsdsplfdlikqsklvpkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlf
    qhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvli
    keeeydsiivfynsvfmqrlktnilqyastrpptlspiphip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pomB (B:)
    gefntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgq
    gcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvma
    tysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehr
    imeslawlsdsplfdlikqsklvprgskstslslfykkvyrlaylrlntlcerllsehpe
    lehiiwtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphav
    qetfkrvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pomB (B:)
    iqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcvei
    gsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatysrs
    tdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawlsdspl
    fdlikqsklvstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneye
    lmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsii
    vfynsvfmqrlktnilqyastrpptlspiphi