PDB entry 3po9

View 3po9 on RCSB PDB site
Description: Crystal structure of PPARgamma ligand binding domain in complex with tripropyltin
Class: transcription
Keywords: transcription, ligand binding domain
Deposited on 2010-11-22, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3po9a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3po9b_
  • Heterogens: XPT, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3po9A (A:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3po9A (A:)
    lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3po9B (B:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3po9B (B:)
    esadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkevairifq
    gcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlise
    gqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktehpl
    lqeiykdly