PDB entry 3po8

View 3po8 on RCSB PDB site
Description: Structural and functional analysis of phosphothreonine-dependent FHA domain interactions
Class: peptide binding protein
Keywords: FHA domain, synthetic peptide, PEPTIDE BINDING PROTEIN
Deposited on 2010-11-22, released 2011-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TB39.8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv0020c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71590 (Start-96)
      • expression tag (97-99)
    Domains in SCOPe 2.05: d3po8a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3po8A (A:)
sagtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvallad
lnstngttvnnapvqewqladgdvirlghseiivrmhplt

    Sequence, based on observed residues (ATOM records): (download) 
    >3po8A (A:)
gtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladln
stngttvnnapvqewqladgdvirlghseiivrmhplt