PDB entry 3po5

View 3po5 on RCSB PDB site
Description: Structure of a mutant of the large fragment of DNA polymerase I from Thermus Auqaticus in complex with an abasic site and ddATP
Class: transferase/DNA
Keywords: DNA polymerase, lesion bypass, apsite, abasic site, TRANSFERASE-DNA complex
Deposited on 2010-11-22, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Thermus aquaticus [TaxId:271]
    Gene: pol1, polA, polI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19821 (Start-539)
      • engineered mutation (321)
      • engineered mutation (454)
    Domains in SCOPe 2.07: d3po5a1, d3po5a2
  • Chain 'B':
    Compound: DNA (5'-d(*gp*ap*cp*cp*ap*cp*gp*gp*cp*gp*cp*(2da))-3')
    Species:
    Gene:
  • Chain 'C':
    Compound: DNA (5'-d(p*(3dr)p*tp*gp*cp*gp*cp*cp*gp*tp*gp*gp*tp*c)-3')
    Species:
    Gene:
  • Heterogens: MG, PGE, DDS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3po5A (A:)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiveki
    lqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgq
    rirrafiaeegwllvaldysqkelrvlahlsgdenlirvfqegrdihtetaswmfgvpre
    avdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektle
    egrrrgyvetlfgrrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprl
    eemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3po5A (A:)
    eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
    dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
    nlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaev
    frlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilq
    yreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqri
    rrafiaeegwllvaldysqkelrvlahlsgdenlirvfqegrdihtetaswplmrraakt
    infgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlf
    grrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprleemgarmllqvh
    delvleapkeraeavarlakevmegvyplavplevevgigedwlsake
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.