PDB entry 3pns

View 3pns on RCSB PDB site
Description: Crystal Structure of Uridine Phosphorylase Complexed with Uracil from Vibrio cholerae O1 biovar El Tor
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta-alpha sandwich, phosphorylase, cytosol, TRANSFERASE
Deposited on 2010-11-19, released 2010-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsa_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnse_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsf_
  • Chain 'G':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsg_
  • Chain 'H':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsh_
  • Chain 'I':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsi_
  • Chain 'J':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsj_
  • Chain 'K':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsk_
  • Chain 'L':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1034
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pnsl_
  • Heterogens: GOL, URA, CL, SO4, FMT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pnsA (A:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsA (A:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pnsB (B:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsB (B:)
    tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
    cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
    pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
    kewqdmgvlnfemesatlltmcassglkagcvagviinrtqhatlketearsikvvveaa
    rkml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pnsC (C:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsC (C:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkedhatlketearsikvv
    veaarkml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pnsD (D:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsD (D:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqhatlketearsikvvvea
    arkml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pnsE (E:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsE (E:)
    tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
    cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
    pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
    kewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeatlketearsikvvvea
    arkml
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3pnsF (F:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsF (F:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkml
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3pnsG (G:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsG (G:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkml
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3pnsH (H:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsH (H:)
    tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
    cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
    pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
    kewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsikv
    vveaarkml
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3pnsI (I:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsI (I:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkml
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3pnsJ (J:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsJ (J:)
    tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
    cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
    pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
    kewqdmgvlnfemesatlltmcassglkagcvagviinrtqlketearsikvvveaarkm
    l
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3pnsK (K:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsK (K:)
    tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
    vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
    fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
    smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
    kvvveaarkml
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3pnsL (L:)
    snamkeppmtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvy
    raeldgqsvvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgs
    vrldgaslhfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtft
    grvvrrfqgsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhat
    lketearsikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pnsL (L:)
    tvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvvv
    cstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhfa
    pmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgsm
    kewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeatlketearsikvvvea
    arkml