PDB entry 3pnr

View 3pnr on RCSB PDB site
Description: Structure of PbICP-C in complex with falcipain-2
Class: hydrolase/hydrolase inhibitor
Keywords: Immunoglobulin fold, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-11-19, released 2011-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.183
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: falcipain 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9N6S8 (0-239)
      • engineered mutation (40)
    Domains in SCOPe 2.03: d3pnra_
  • Chain 'B':
    Compound: PbICP-C
    Species: Plasmodium berghei [TaxId:5821]
    Gene: PB000502.02.0
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pnrA (A:)
mnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgsawafssigsvesqyairknk
litlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrcte
kygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvgf
gmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafiplie

  • Chain 'B':
    No sequence available.