PDB entry 3pn7

View 3pn7 on RCSB PDB site
Description: Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Class: protein binding
Keywords: alpha helix, muscle contraction, Calcium binding, Catch Muscle, PROTEIN BINDING
Deposited on 2010-11-18, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pn7b_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pn7c_
  • Chain 'D':
    Compound: myosin heavy chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: myosin regulatory light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pn7e_
  • Chain 'F':
    Compound: myosin essential light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pn7f_
  • Heterogens: MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pn7B (B:)
    adkeraqratsnvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddke
    ltamlkeapgplnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllen
    mgdnfnkdemrmtfkeapveggkfdyvrfvamikgsgddda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pn7B (B:)
    rlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnft
    mflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtfk
    eapveggkfdyvrfvamikgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pn7C (C:)
    pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde
    evdeiinltdlqedlegnvkyeefvkkvmtgpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pn7C (C:)
    klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
    vdeiinltdlqedlegnvkyeefvkkvmtgpy
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pn7E (E:)
    adkeraqratsnvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddke
    ltamlkeapgplnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllen
    mgdnfnkdemrmtfkeapveggkfdyvrfvamikgsgddda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pn7E (E:)
    nvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgp
    lnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemr
    mtfkeapveggkfdyvrfvamikgs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3pn7F (F:)
    pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde
    evdeiinltdlqedlegnvkyeefvkkvmtgpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pn7F (F:)
    klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
    vdeiinltdlqedlegnvkyeefvkkvmtgp