PDB entry 3pmt

View 3pmt on RCSB PDB site
Description: Crystal structure of the Tudor domain of human Tudor domain-containing protein 3
Class: transcription
Keywords: Tudor domain, Structural Genomics Consortium, SGC, sulfur phasing, Nucleus, TRANSCRIPTION
Deposited on 2010-11-18, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tudor domain-containing protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: Tdrd3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H7E2
  Domains in SCOPe 2.07: d3pmta_
• Heterogens: PG4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3pmtA (A:)
  akmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpiqte
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3pmtA (A:)
  kmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi