PDB entry 3pmt

View 3pmt on RCSB PDB site
Description: Crystal structure of the Tudor domain of human Tudor domain-containing protein 3
Class: transcription
Keywords: Tudor domain, Structural Genomics Consortium, SGC, sulfur phasing, Nucleus, TRANSCRIPTION
Deposited on 2010-11-18, released 2010-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Tdrd3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pmta_
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pmtA (A:)
    akmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpiqte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pmtA (A:)
    kmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi