PDB entry 3pmj

View 3pmj on RCSB PDB site
Description: Bovine trypsin variant X(tripleIle227) in complex with small molecule inhibitor
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Trypsin-like serine protease, HYDROLASE, PROTEIN BINDING, DUODENUM, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-11-17, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.177
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (171)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d3pmja_
  • Heterogens: CA, PMJ, GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pmjA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgsgcaqknkpgiytkvcnyvswikqtiasn