PDB entry 3pm0

View 3pm0 on RCSB PDB site
Description: Structural Characterization of the Complex between Alpha-Naphthoflavone and Human Cytochrome P450 1B1 (CYP1B1)
Class: oxidoreductase
Keywords: cyp1b1, p450 1b1, p450, monooxygenase, alpha-naphthoflavone, heme, 17beta-estradiol, oxidoreductase
Deposited on 2010-11-15, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 1B1
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP1B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16678
      • see remark 999 (78)
    Domains in SCOPe 2.07: d3pm0a_
  • Heterogens: HEM, BHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pm0A (A:)
    makktsskgkppgpfawplignaaavgqaahlsfarlarrygdvfqirlgscpivvlnge
    raihqalvqqgsafadrpsfasfrvvsggrsmafghysehwkvqrraahsmmrnfftrqp
    rsrqvleghvlsearelvallvrgsadgafldprpltvvavanvmsavcfgcryshddpe
    frellshneefgrtvgagslvdvmpwlqyfpnpvrtvfrefeqlnrnfsnfildkflrhc
    eslrpgaaprdmmdafilsaekkaagdshgggarldlenvpatitdifgasqdtlstalq
    wllllftrypdvqtrvqaeldqvvgrdrlpcmgdqpnlpyvlaflyeamrfssfvpvtip
    hattantsvlgyhipkdtvvfvnqwsvnhdplkwpnpenfdparfldkdglinkdltsrv
    mifsvgkrrcigeelskmqlflfisilahqcdfranpnepakmnfsygltikpksfkvnv
    tlresmelldsavqnlqaketcqhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pm0A (A:)
    qaahlsfarlarrygdvfqirlgscpivvlngeraihqalvqqgsafadrpsfasfrvvs
    ggrsmafghysehwkvqrraahsmmrnfftrqprsrqvleghvlsearelvallvrgsad
    gafldprpltvvavanvmsavcfgcryshddpefrellshneefgrtvgagslvdvmpwl
    qyfpnpvrtvfrefeqlnrnfsnfildkflrhceslrpgaaprdmmdafilsaekkaagd
    garldlenvpatitdifgasqdtlstalqwllllftrypdvqtrvqaeldqvvgrdrlpc
    mgdqpnlpyvlaflyeamrfssfvpvtiphattantsvlgyhipkdtvvfvnqwsvnhdp
    lkwpnpenfdparfldkdglinkdltsrvmifsvgkrrcigeelskmqlflfisilahqc
    dfranpnepakmnfsygltikpksfkvnvtlresmelld