PDB entry 3ply

View 3ply on RCSB PDB site
Description: Structure of Oxidized P96G Mutant of Amicyanin
Class: electron transport
Keywords: type-I blue copper protein; beta sandwich, electron transport, metal-binding
Deposited on 2010-11-15, released 2011-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.243
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (95)
    Domains in SCOPe 2.05: d3plya_
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (95)
    Domains in SCOPe 2.05: d3plyb_
  • Chain 'C':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (95)
    Domains in SCOPe 2.05: d3plyc_
  • Chain 'D':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (95)
    Domains in SCOPe 2.05: d3plyd_
  • Heterogens: CU, NA, PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3plyA (A:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphgfmrgkvvve

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3plyB (B:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphgfmrgkvvve

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3plyC (C:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphgfmrgkvvve

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3plyD (D:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphgfmrgkvvve