PDB entry 3pls

View 3pls on RCSB PDB site
Description: RON in complex with ligand AMP-PNP
Class: transferase
Keywords: PROTEIN KINASE, cis autophosphorylation conformation, receptor tyrosine kinase, AMP-PNP, unphosphorylated, single-span transmembrane receptor, TRANSFERASE
Deposited on 2010-11-15, released 2010-11-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.235
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage-stimulating protein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MST1R, PTK8, RON
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04912 (0-297)
      • see remark 999 (135)
      • engineered mutation (194)
    Domains in SCOPe 2.05: d3plsa_
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3plsA (A:)
    rdldsallaevkdvliphervvthsdrvigkghfgvvyhgeyidqaqnriqcaikslsri
    temqqveaflregllmrglnhpnvlaligimlppeglphvllpymchgdllqfirspqrn
    ptvkdlisfglqvargmeylaeqkfvhrdlaarncmldesftvkvadfglardildreyy
    svqqhrharlpvkwtaleslqtyrfttksdvwsfgvllwelltrgappyrhidpfdlthf
    laqgrrlpqpeycpdslyqvmqqcweadpavrptfrvlvgeveqivsallgdhyvqlp