PDB entry 3plb

View 3plb on RCSB PDB site
Description: Bovine trypsin variant X(tripleIle227) in complex with small molecule inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Trypsin-like serine protease, PROTEIN BINDING, DUODENUM, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-11-15, released 2011-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.13
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (171)
      • engineered mutation (204)
    Domains in SCOPe 2.08: d3plba_
  • Heterogens: CA, BEN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3plbA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgsgcaqknkpgiytkvcnyvswikqtiasn