PDB entry 3pl6

View 3pl6 on RCSB PDB site
Description: Structure of Autoimmune TCR Hy.1B11 in complex with HLA-DQ1 and MBP 85-99
Class: immune system
Keywords: TCR-MHC complex, Immunoglobulin fold, Immune receptor, Membrane, IMMUNE SYSTEM
Deposited on 2010-11-13, released 2010-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pl6a1, d3pl6a2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pl6b1, d3pl6b2
  • Chain 'C':
    Compound: T-cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PL6 (0-End)
    Domains in SCOPe 2.04: d3pl6c1, d3pl6c2
  • Chain 'D':
    Compound: MBP peptide / T-cell receptor beta chain chimera
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3YTB3 (Start-16)
    • PDB 3PL6 (24-End)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pl6A (A:)
    edivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpq
    galrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkh
    wepeipapmselte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pl6A (A:)
    divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
    alrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhw
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pl6B (B:)
    egrdspedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpva
    eywnsqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsrtealnhhnllics
    vtdfypsqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehp
    slqspitvewraqsesaqskvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pl6B (B:)
    spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
    sqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsnllicsvtdfypsqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    q
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pl6C (C:)
    enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
    iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspesss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pl6C (C:)
    enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
    iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnns
    

  • Chain 'D':
    No sequence available.