PDB entry 3pkm

View 3pkm on RCSB PDB site
Description: Crystal structure of Cas6 with its substrate RNA
Class: hydrolase/RNA
Keywords: Cas6, CRISPR, endonuclease, Ferridoxin fold, CRISPR processing endonuclease, repeat RNA, HYDROLASE-RNA complex
Deposited on 2010-11-11, released 2011-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.308
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cas6 protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1131
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1S4 (6-End)
      • expression tag (0-5)
    Domains in SCOPe 2.08: d3pkma1, d3pkma2, d3pkma3
  • Chain 'G':
    Compound: 5'-r(*ap*up*up*ap*cp*ap*ap*up*ap*a)-3'
  • Chain 'R':
    Compound: 5'-r(p*up*up*ap*cp*ap*ap*up*ap*a)-3'
  • Chain 'X':
    Compound: Cas6 protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1131
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1S4 (6-End)
      • expression tag (0-5)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pkmA (A:)
    hhhhgsrflirlvpedkdrafkvpynhqyylqgliynaikssnpklatylhevkgpklft
    yslfmaekrehpkglpyflgykkgffyfstcvpeiaealvngllmnpevrlwderfylhe
    ikvlrepkkfngstfvtlspiavtvvrkgksydvppmekefysiikddlqdkyvmaygdk
    ppsefemevliakpkrfrikpgiyqtawhlvfraygnddllkvgyevgfgeknslgfgmv
    kvegnkttkeaeeqekitfnsreelktgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pkmA (A:)
    hhhhgsrflirlvafkvpynhqyylqgliynaikssnpklatylhevkgpklftyslfma
    ekrehpyflgykkgffyfstcvpeiaealvngllmnpevrlwderfylheikvlrepkkf
    ngstfvtlspiavtvvydvppmekefysiikddlqdkyvmaygdkppsefemevliakpk
    rfrikpgiyqtawhlvfraygnddllkvgyevgfgeknslgfgmvkveg
    

  • Chain 'G':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'X':
    No sequence available.