PDB entry 3pk2

View 3pk2 on RCSB PDB site
Description: Artificial Transfer Hydrogenases for the Enantioselective Reduction of Cyclic Imines
Class: biotin-binding protein
Keywords: beta-barrel, biotin-binding protein, biotin, biotinylated metals, cytosol
Deposited on 2010-11-11, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (12)
      • engineered mutation (111)
    Domains in SCOPe 2.07: d3pk2a1, d3pk2a2
  • Heterogens: 4IR, IR3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pk2A (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltagtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pk2A (A:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltagtteanawkstlvghdtftk
    vk