PDB entry 3pjq

View 3pjq on RCSB PDB site
Description: Trypanosoma cruzi trans-sialidase-like inactive isoform (including the natural mutation Tyr342His) in complex with lactose
Class: sugar binding protein
Keywords: beta-propeller, lectin / similar to actve trans-sialidases, lactose, SUGAR BINDING PROTEIN
Deposited on 2010-11-10, released 2011-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-sialidase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26966 (14-End)
      • expression tag (12-13)
      • engineered mutation (71)
      • see remark 999 (275)
      • see remark 999 (355)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered mutation (508-509)
      • engineered mutation (533)
      • see remark 999 (571)
      • engineered mutation (606)
      • engineered mutation (610)
      • engineered mutation (612)
    Domains in SCOPe 2.05: d3pjqa1, d3pjqa2
  • Heterogens: LBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pjqA (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensahssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pjqA (A:)
    aslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsf
    dnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrs
    ywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflgg
    agvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvaleweg
    kliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmr
    vmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensahssvlykddklyclhei
    nsnevyslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsa
    tktewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvas
    vtihevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhv
    vltmankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvll
    ynrqlnaeeirtlflsqdligteahm