PDB entry 3pj3

View 3pj3 on RCSB PDB site
Description: Crystal structure of BTK kinase domain complexed with 2-Methyl-5-[(E)-(3-phenyl-acryloyl)amino]-N-(2-phenyl-3H-imidazo[4,5-b]pyridin-6-yl)-benzamide
Class: transferase/inhibitor
Keywords: helix C-in, DFG-out, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2010-11-08, released 2011-01-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.234
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: AGMX1, ATK, BPK, BTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3pj3a_
  • Heterogens: 04L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pj3A (A:)
    gtaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefiee
    akvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdv
    ceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsp
    pevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasek
    vytimyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pj3A (A:)
    gygsweidpkdltflkelgtgvvkygkwrgqydvaikmidefieeakvmmnlsheklvql
    ygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskqflhr
    dlaarnclvndqgvvkvsdfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpye
    rftnsetaehiaqglrlyrphlasekvytimyscwhekaderptfkillsnildvmdees