PDB entry 3piy

View 3piy on RCSB PDB site
Description: Crystal structure of BTK kinase domain complexed with R406
Class: transferase/inhibitor
Keywords: helix C-out, DFG-in, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2010-11-08, released 2011-01-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: AGMX1, ATK, BPK, BTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3piya_
  • Heterogens: 585, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3piyA (A:)
    gtaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefiee
    akvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdv
    ceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsp
    pevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasek
    vytimyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3piyA (A:)
    gygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmiedefieeakvmmnlshek
    lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
    flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
    ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
    kaderptfkillsnildvmdee