PDB entry 3piu

View 3piu on RCSB PDB site
Description: High-resolution structure of native Malus domestica ACC synthase
Class: lyase
Keywords: FRUIT RIPENING, ETHYLENE BIOSYNTHESIS, lyase, Pyridoxal 5'-phosphate binding
Deposited on 2010-11-08, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.149
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate synthase
    Species: Malus domestica [TaxId:3750]
    Gene: ACS-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37821
      • microheterogeneity (272)
    Domains in SCOPe 2.07: d3piua_
  • Heterogens: PLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3piuA (A:)
    mrmlsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswla
    knpeaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltaga
    tsanetfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetalee
    ayqeaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafss
    psfisvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkms
    sfglvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglf
    cwvdmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldl
    amqrlkafvgeyynv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3piuA (A:)
    syflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaaafkkngesifa
    elalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanetfifcladpgea
    vliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeaekrnlrvkgvlv
    tnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisvmevlkdevwqr
    vhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvssqtqhllsamlsdkkltk
    nyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmrhllrsntfeaemelwkki
    vyevhlnispgsschctepgwfrvcfanlpertldlamqrlkafvgeyy