PDB entry 3phy

View 3phy on RCSB PDB site
Description: photoactive yellow protein, dark state (unbleached), solution structure, nmr, 26 structures
Deposited on 1998-02-06, released 1998-05-27
The last revision prior to the SCOP 1.59 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d3phy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3phy_ (-)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv