PDB entry 3phq

View 3phq on RCSB PDB site
Description: Crystal structure of S64-4 in complex with KDO
Class: carbohydrate-binding protein
Keywords: antibody, Fab, IgG, carbohydrate, CARBOHYDRATE-BINDING PROTEIN
Deposited on 2010-11-04, released 2011-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S64-4 Fab (IgG1) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PHQ (Start-216)
    Domains in SCOPe 2.08: d3phqa1, d3phqa2
  • Chain 'B':
    Compound: S64-4 Fab (IgG1) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PHQ (0-221)
    Domains in SCOPe 2.08: d3phqb_
  • Heterogens: KDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3phqA (A:)
    divltqspaslavslgqratiscrasksvsssvnsymhwyqqkpgqppklliylasnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhsrelrtfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phqA (A:)
    ivltqspaslavslgqratiscrasksvsssvnsymhwyqqkpgqppklliylasnlesg
    vparfsgsgsgtdftlnihpveeedaatyycqhsrelrtfgggtkleikradaaptvsif
    ppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsst
    ltltkdeyerhnsytceathktstspvvksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3phqB (B:)
    evmlvesggglvqpggslrlscatsgftfidyymswvrqppgkalewlgfirnkgngytt
    eystsvkgrftisrdnsqsavylqmntlraedsatyycardigygnspfaywgqgtlvtv
    saasitppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phqB (B:)
    evmlvesggglvqpggslrlscatsgftfidyymswvrqppgkalewlgfirnkgngytt
    eystsvkrftisrdnsavylqmntlraedsatyycardigygnspfaywgqgtlvtvsaa
    sitppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivpr