PDB entry 3pho

View 3pho on RCSB PDB site
Description: Crystal structure of S64-4 in complex with PSBP
Class: carbohydrate-binding protein
Keywords: antibody, Fab, IgG, carbohydrate, CARBOHYDRATE-BINDING PROTEIN
Deposited on 2010-11-04, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S64-4 Fab (IgG1) light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3PHO (Start-216)
    Domains in SCOPe 2.07: d3phoa1, d3phoa2
  • Chain 'B':
    Compound: S64-4 Fab (IgG1) heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3PHO (0-221)
  • Heterogens: KD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3phoA (A:)
    divltqspaslavslgqratiscrasksvsssvnsymhwyqqkpgqppklliylasnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhsrelrtfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phoA (A:)
    ivltqspaslavslgqratiscrasksvsssvnsymhwyqqkpgqppklliylasnlesg
    vparfsgsgsgtdftlnihpveeedaatyycqhsrelrtfgggtkleikradaaptvsif
    ppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsst
    ltltkdeyerhnsytceathktstspvvksfnrnec
    

  • Chain 'B':
    No sequence available.