PDB entry 3phn

View 3phn on RCSB PDB site
Description: Crystal structure of wild-type onconase with resolution 1.46 A
Class: hydrolase, antitumor protein
Keywords: Onconase, Protein P-30, Ranpirnase, Endonuclease, Nuclease, Hydrolase, Alpha and beta protein, ANTITUMOR PROTEIN
Deposited on 2010-11-04, released 2010-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.152
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein P-30
  Species: Rana pipiens [TaxId:8404]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22069 (0-103)
  Domains in SCOPe 2.03: d3phna_
• Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3phnA (A:)
  edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
  sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc