PDB entry 3phn

View 3phn on RCSB PDB site
Description: Crystal structure of wild-type onconase with resolution 1.46 A
Class: hydrolase, antitumor protein
Keywords: Onconase, Protein P-30, Ranpirnase, Endonuclease, Nuclease, Hydrolase, Alpha and beta protein, ANTITUMOR PROTEIN
Deposited on 2010-11-04, released 2010-11-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.152
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein P-30
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3phna_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3phnA (A:)
    edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
    sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc