PDB entry 3phm

View 3phm on RCSB PDB site
Description: reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm)
Class: oxidoreductase
Keywords: monooxygenase, bioactive peptide activation, ascorbate, oxidoreductase
Deposited on 1999-05-25, released 1999-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peptidylglycine alpha-hydroxylating monooxygenase)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3phma1, d3phma2
  • Heterogens: CU, AZI, NI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3phmA (A:)
    neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
    tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
    kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
    iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
    fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
    tipaeanipi