PDB entry 3phj

View 3phj on RCSB PDB site
Description: Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori in complex with 3-Dehydroshikimate
Class: oxidoreductase
Keywords: shikimate dehydrogenase, shikimate pathway, Helicobacter pylori, oxidoreductase, alpha/beta domain, Rossmann fold
Deposited on 2010-11-04, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3phja1, d3phja2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3phjb1, d3phjb2
  • Heterogens: DHK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3phjA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phjA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkyqnali
    lgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinatsel
    plnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaalsfekfsas
    qipyskafevmrsvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3phjB (B:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phjB (B:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkyqnali
    lgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinatsel
    plnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaalsfekfsas
    qipyskafevmrsvf