PDB entry 3phh

View 3phh on RCSB PDB site
Description: Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori in complex with Shikimate
Class: oxidoreductase
Keywords: shikimate dehydrogenase, shikimate pathway, Helicobacter pylori, oxidoreductase, alpha/beta domain, Rossmann fold
Deposited on 2010-11-04, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.199
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3phha1, d3phha2
  • Heterogens: SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3phhA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phhA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkyqnali
    lgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinatsas
    lhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaalsfe
    kfsasqipyskafevmrsvf