PDB entry 3phg

View 3phg on RCSB PDB site
Description: Crystal structure of the Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori
Class: oxidoreductase
Keywords: shikimate dehydrogenase, shikimate pathway, Helicobacter pylori, oxidoreductase, alpha/beta domain, Rossmann fold
Deposited on 2010-11-04, released 2011-11-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.202
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3phga1, d3phga2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3phgb1, d3phgb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3phgA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phgA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkyqnali
    lgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinatsas
    lhnelplnkevlkgyfkegklaydlayltpflslakelktpfqdgkdmliyqaalsfekf
    sasqipyskafevmrsvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3phgB (B:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phgB (B:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkyqnali
    lgaggsakalacelkkqglqvsvlgldffqrlgcdcfmeppksafdliinatsaslhnel
    plnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyqaalsfekfsas
    qipyskafevmrsvf