PDB entry 3phb

View 3phb on RCSB PDB site
Description: Crystal Structure of human purine nucleoside phosphorylase in complex with DADMe-ImmG
Class: transferase/transferase inhibitor
Keywords: PNP,Immucillin, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-11-03, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP, NP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00491 (35-End)
      • expression tag (32-34)
      • conflict (85)
    Domains in SCOPe 2.06: d3phbe1, d3phbe2
  • Chain 'Q':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP, NP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00491 (35-End)
      • expression tag (33-34)
      • conflict (85)
    Domains in SCOPe 2.06: d3phbq1, d3phbq2
  • Chain 'S':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP, NP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00491 (35-End)
      • expression tag (34)
      • conflict (85)
    Domains in SCOPe 2.06: d3phbs1, d3phbs2
  • Chain 'T':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP, NP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00491 (35-End)
      • expression tag (32-34)
      • conflict (85)
    Domains in SCOPe 2.06: d3phbt1, d3phbt2
  • Chain 'U':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP, NP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00491
      • conflict (85)
    Domains in SCOPe 2.06: d3phbu_
  • Chain 'Y':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP, NP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00491 (35-End)
      • conflict (85)
    Domains in SCOPe 2.06: d3phby_
  • Heterogens: IM5, PO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3phbE (E:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptlmengytyedykntaewllshtkhrp
    qvaiicgsglggltdkltqaqifdyseipnfprstvpghagrlvfgflngracvmmqgrf
    hmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfevgdimlirdhinlpgfsgqn
    plrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqrelqegtyvmvagpsfetvae
    crvlqklgadavgmstvpevivarhcglrvfgfslitnkvimdyeslekanheevlaagk
    qaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phbE (E:)
    ptlmengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfp
    rstvpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaa
    gglnpkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralst
    wkqmgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfg
    fslitnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3phbQ (Q:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptlmengytyedykntaewllshtkhrp
    qvaiicgsglggltdkltqaqifdyseipnfprstvpghagrlvfgflngracvmmqgrf
    hmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfevgdimlirdhinlpgfsgqn
    plrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqrelqegtyvmvagpsfetvae
    crvlqklgadavgmstvpevivarhcglrvfgfslitnkvimdyeslekanheevlaagk
    qaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phbQ (Q:)
    tlmengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfpr
    stvpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaag
    glnpkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstw
    kqmgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgf
    slitnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3phbS (S:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptlmengytyedykntaewllshtkhrp
    qvaiicgsglggltdkltqaqifdyseipnfprstvpghagrlvfgflngracvmmqgrf
    hmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfevgdimlirdhinlpgfsgqn
    plrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqrelqegtyvmvagpsfetvae
    crvlqklgadavgmstvpevivarhcglrvfgfslitnkvimdyeslekanheevlaagk
    qaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phbS (S:)
    lmengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprs
    tvpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagg
    lnpkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwk
    qmgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfs
    litnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3phbT (T:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptlmengytyedykntaewllshtkhrp
    qvaiicgsglggltdkltqaqifdyseipnfprstvpghagrlvfgflngracvmmqgrf
    hmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfevgdimlirdhinlpgfsgqn
    plrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqrelqegtyvmvagpsfetvae
    crvlqklgadavgmstvpevivarhcglrvfgfslitnkvimdyeslekanheevlaagk
    qaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phbT (T:)
    ptlmengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfp
    rstvpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaa
    gglnpkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralst
    wkqmgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfg
    fslitnkvimdyeslekanheevlaagkqaaqkleqfvsilmasipl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3phbU (U:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptlmengytyedykntaewllshtkhrp
    qvaiicgsglggltdkltqaqifdyseipnfprstvpghagrlvfgflngracvmmqgrf
    hmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfevgdimlirdhinlpgfsgqn
    plrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqrelqegtyvmvagpsfetvae
    crvlqklgadavgmstvpevivarhcglrvfgfslitnkvimdyeslekanheevlaagk
    qaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phbU (U:)
    ngytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvp
    ghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnp
    kfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqmg
    eqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslit
    nkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdk
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3phbY (Y:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptlmengytyedykntaewllshtkhrp
    qvaiicgsglggltdkltqaqifdyseipnfprstvpghagrlvfgflngracvmmqgrf
    hmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfevgdimlirdhinlpgfsgqn
    plrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqrelqegtyvmvagpsfetvae
    crvlqklgadavgmstvpevivarhcglrvfgfslitnkvimdyeslekanheevlaagk
    qaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phbY (Y:)
    mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
    vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
    npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
    mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp