PDB entry 3pgz

View 3pgz on RCSB PDB site
Description: Crystal structure of a single strand binding protein (SSB) from bartonella henselae
Class: DNA binding protein
Keywords: SSGCID, BARTONELLA HENSELAE, SINGLE-STRAND BINDING PROTEIN, Seattle Structural Genomics Center for Infectious Disease, DNA BINDING PROTEIN
Deposited on 2010-11-03, released 2010-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Bartonella henselae [TaxId:38323]
    Gene: BH10130, ssb4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pgza_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Bartonella henselae [TaxId:38323]
    Gene: BH10130, ssb4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pgzb_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pgzA (A:)
    mahhhhhhmgtleaqtqgpgsmagslnkvilignlgadpeirrlnsgdqvanlriatses
    wrdrntnerkertewhnivifnenlvkvveqylkkgskiyiegqlqtrkwqdqngndryt
    teivlqkyrgelqmldgraaaggeqmqganqssgayssvgfgdnsanqrdvfgsnnsqlg
    esfshkldddvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgzA (A:)
    agslnkvilignlgadpeirrlnsgdqvanlriatseswrdrkertewhnivifnenlvk
    vveqylkkgskiyiegqlqtrkwqdqngndrytteivlqkyrgelqmld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pgzB (B:)
    mahhhhhhmgtleaqtqgpgsmagslnkvilignlgadpeirrlnsgdqvanlriatses
    wrdrntnerkertewhnivifnenlvkvveqylkkgskiyiegqlqtrkwqdqngndryt
    teivlqkyrgelqmldgraaaggeqmqganqssgayssvgfgdnsanqrdvfgsnnsqlg
    esfshkldddvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgzB (B:)
    agslnkvilignlgadpeirrlnsgdqvanlriatseswrdrntnerkertewhnivifn
    enlvkvveqylkkgskiyiegqlqtrkwqdqngndrytteivlqkyrgelqmld