PDB entry 3pgv

View 3pgv on RCSB PDB site
Description: Crystal structure of a haloacid dehalogenase-like hydrolase (KPN_04322) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.39 A resolution
Class: hydrolase
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, hydrolase
Deposited on 2010-11-02, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.169
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: yigL, KPN78578_42660, KPN_04322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgva_
  • Chain 'B':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: yigL, KPN78578_42660, KPN_04322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgvb_
  • Chain 'C':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: yigL, KPN78578_42660, KPN_04322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgvc_
  • Chain 'D':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: yigL, KPN78578_42660, KPN_04322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgvd_
  • Heterogens: CA, EPE, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pgvA (A:)
    mgsdkihhhhhhenlyfqgmyqvvasdldgtllspdhfltpyaketlklltarginfvfa
    tgrhyidvgqirdnlgirsymitsngarvhdsdgqqifahnldrdiaadlfeivrndpki
    vtnvyredewymnrhrpeemrffkeavfnyklyepgeldpqgiskvfftcedhehllple
    qamnarwgdrvnvsfstltclevmaggvskghaleavakmlgytlsdciafgdgmndaem
    lsmagkgcimanahqrlkdlhpelevigsnaddavprylrklyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgvA (A:)
    yqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirsy
    mitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrffke
    avfnyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevma
    ggvskghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpele
    vigsnaddavprylrklyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pgvB (B:)
    mgsdkihhhhhhenlyfqgmyqvvasdldgtllspdhfltpyaketlklltarginfvfa
    tgrhyidvgqirdnlgirsymitsngarvhdsdgqqifahnldrdiaadlfeivrndpki
    vtnvyredewymnrhrpeemrffkeavfnyklyepgeldpqgiskvfftcedhehllple
    qamnarwgdrvnvsfstltclevmaggvskghaleavakmlgytlsdciafgdgmndaem
    lsmagkgcimanahqrlkdlhpelevigsnaddavprylrklyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgvB (B:)
    myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
    ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpvf
    nyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevmaggv
    skghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpelevig
    snaddavprylrklyld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pgvC (C:)
    mgsdkihhhhhhenlyfqgmyqvvasdldgtllspdhfltpyaketlklltarginfvfa
    tgrhyidvgqirdnlgirsymitsngarvhdsdgqqifahnldrdiaadlfeivrndpki
    vtnvyredewymnrhrpeemrffkeavfnyklyepgeldpqgiskvfftcedhehllple
    qamnarwgdrvnvsfstltclevmaggvskghaleavakmlgytlsdciafgdgmndaem
    lsmagkgcimanahqrlkdlhpelevigsnaddavprylrklyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgvC (C:)
    myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
    ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpav
    fnyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevmagg
    vskghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpelevi
    gsnaddavprylrklyld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pgvD (D:)
    mgsdkihhhhhhenlyfqgmyqvvasdldgtllspdhfltpyaketlklltarginfvfa
    tgrhyidvgqirdnlgirsymitsngarvhdsdgqqifahnldrdiaadlfeivrndpki
    vtnvyredewymnrhrpeemrffkeavfnyklyepgeldpqgiskvfftcedhehllple
    qamnarwgdrvnvsfstltclevmaggvskghaleavakmlgytlsdciafgdgmndaem
    lsmagkgcimanahqrlkdlhpelevigsnaddavprylrklyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgvD (D:)
    myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
    ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpvf
    nyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevmaggv
    skghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpelevig
    snaddavprylrklyld