PDB entry 3pgq

View 3pgq on RCSB PDB site
Description: Crystal Structure of the Carboxyltransferase Domain of S. cerevisiae Acetyl CoA Carboxylase in Complex with Pinoxaden
Class: ligase
Keywords: Transferase, carboxyltransferase, LIGASE
Deposited on 2010-11-02, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FAS3, ACC1, YNR016C, N3175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgqa1, d3pgqa2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FAS3, ACC1, YNR016C, N3175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgqb1, d3pgqb2
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FAS3, ACC1, YNR016C, N3175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pgqc1, d3pgqc2
  • Heterogens: GY3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pgqA (A:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgqA (A:)
    lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
    neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
    edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
    segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
    hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
    tqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptnde
    tydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtv
    enlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgg
    qrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvn
    aragvlepqgmvgikfrreklldtmnrlddkyrellpiygqislqfadlhdrssrmvakg
    viskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdhed
    drqvatwieenyktlddklkglklesfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pgqB (B:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgqB (B:)
    lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
    neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
    edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
    segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
    hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
    tqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptnde
    tydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtv
    enlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgg
    qrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvn
    aragvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviske
    lewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqva
    twieenyktlddklkglkle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pgqC (C:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgqC (C:)
    ewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengel
    teverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvtey
    arkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfd
    kensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtc
    rsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvsh
    ltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegr
    etesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanp
    nsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlky
    gsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgm
    vgikfrreklldtmnrlddkyrellpiygqislqfadlhdrssrmvakgviskelewtea
    rrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieen
    yktlddklkglkles