PDB entry 3pgp

View 3pgp on RCSB PDB site
Description: Crystal structure of PA4794 - GNAT superfamily protein in complex with AcCoA
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, acetyltransferase, GNAT family, PSI, TRANSFERASE
Deposited on 2010-11-02, released 2010-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein PA4794
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pgpa_
  • Heterogens: EDO, ACO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pgpA (A:)
    ghmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhd
    gqvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscf
    nanaaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgpA (A:)
    mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
    vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
    naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple