PDB entry 3pgm

View 3pgm on RCSB PDB site
Description: the structure of yeast phosphoglycerate mutase at 0.28 nm resolution
Class: transferase (phosphoryl)
Keywords: transferase (phosphoryl)
Deposited on 1982-04-06, released 1982-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00950 (0-End)
      • conflict (45)
      • conflict (47-49)
      • conflict (51)
      • conflict (98)
      • conflict (169)
      • conflict (173)
      • conflict (204)
      • conflict (206-207)
    Domains in SCOPe 2.07: d3pgma_
  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00950 (0-End)
      • conflict (45)
      • conflict (47-49)
      • conflict (51)
      • conflict (98)
      • conflict (169)
      • conflict (173)
      • conflict (204)
      • conflict (206-207)
    Domains in SCOPe 2.07: d3pgmb_
  • Heterogens: SO4, 3PG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pgmA (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekgvnvlvdytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaqtlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviaklvgktsmiaahg
    nslrglvkhlegisdadiaklnippgtilvfeldenlkpskpsyyldpeaaaagaaavan
    qgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgmA (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekgvnvlvdytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaqtlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviaklvgktsmiaahg
    nslrglvkhlegisdadiaklnippgtilvfeldenlkpskpsyyldpea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pgmB (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekgvnvlvdytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaqtlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviaklvgktsmiaahg
    nslrglvkhlegisdadiaklnippgtilvfeldenlkpskpsyyldpeaaaagaaavan
    qgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgmB (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekgvnvlvdytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaqtlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviaklvgktsmiaahg
    nslrglvkhlegisdadiaklnippgtilvfeldenlkpskpsyyldpea