PDB entry 3pgm

View 3pgm on RCSB PDB site
Description: the structure of yeast phosphoglycerate mutase at 0.28 nm resolution
Deposited on 1982-04-06, released 1982-05-26
The last revision prior to the SCOP 1.55 freeze date was dated 1984-02-17, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.29
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3pgm__
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pgm_ (-)
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekgvnvlvdytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaqtlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviaklvgktsmiaahg
nslrglvkhlegisdadiaklnippgtilvfeldenlkpskpsyyldpea

  • Chain 'B':
    No sequence available.