PDB entry 3pgk

View 3pgk on RCSB PDB site
Description: the structure of yeast phosphoglycerate kinase at 0.25 nm resolution
Deposited on 1982-07-15, released 1982-09-24
The last revision prior to the SCOP 1.55 freeze date was dated 1992-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3pgk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pgk_ (-)
    slssklsvqdldlkdkrvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvla
    shlgrpngernekyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenl
    ryhieeegsrkvdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpq
    raagfllekelkyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaft
    fkkvlenteigdsifdkavgpeiaklmekakakgvevvlpvdfiiadafsasantktvtd
    kegipagwqgldngpesrklfaatvakatvilwngppgvfefekfaagtkalldevvkss
    aagntviigggdtatvakkygvtdkishvstgggaslellegkelpgvaflsekk