PDB entry 3pgk

View 3pgk on RCSB PDB site
Description: The structure of yeast phosphoglycerate kinase at 0.25 nm resolution
Class: transferase
Keywords: phosphotransferase(carboxyl as acceptor), transferase
Deposited on 1982-07-15, released 1982-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00560 (0-414)
      • insertion (258)
      • conflict (260)
      • conflict (263)
      • conflict (291)
      • conflict (328-329)
      • conflict (331)
    Domains in SCOPe 2.07: d3pgka_
  • Heterogens: MG, ATP, 3PG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pgkA (A:)
    slssklsvqdldlkdkrvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvla
    shlgrpngernekyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenl
    ryhieeegsrkvdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpq
    raagfllekelkyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaft
    fkkvlenteigdsifdkavgpeiaklmekakakgvevvlpvdfiiadafsasantktvtd
    kegipagwqgldngpesrklfaatvakatvilwngppgvfefekfaagtkalldevvkss
    aagntviigggdtatvakkygvtdkishvstgggaslellegkelpgvaflsekk