PDB entry 3pgg

View 3pgg on RCSB PDB site
Description: Crystal structure of cryptosporidium parvum u6 snrna-associated sm-like protein lsm5
Class: DNA binding protein
Keywords: U6 SNRNA-ASSOCIATED SM-LIKE PROTEIN, LSM5, DNA BINDING PROTEIN, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2010-11-01, released 2011-02-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm5. SM domain
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: cgd7_4580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3pgga_
  • Chain 'B':
    Compound: U6 snRNA-associated Sm-like protein LSm5. SM domain
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: cgd7_4580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3pggb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pggA (A:)
    sykvnymsetpanksqggsnqkggniilplalidkcignriyvvmkgdkefsgvlrgfde
    yvnmvlddvqeygfkadeedisggnkklkrvmvnrletillsgnnvamlvpggdpdsfnf
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pggA (A:)
    niilplalidkcignriyvvmkgdkefsgvlrgfdeyvnmvlddvqeygfkadkrvmvnr
    letillsgnnvamlvpgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pggB (B:)
    sykvnymsetpanksqggsnqkggniilplalidkcignriyvvmkgdkefsgvlrgfde
    yvnmvlddvqeygfkadeedisggnkklkrvmvnrletillsgnnvamlvpggdpdsfnf
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pggB (B:)
    ggniilplalidkcignriyvvmkgdkefsgvlrgfdeyvnmvlddvqeygfkakrvmvn
    rletillsgnnvamlvpggd