PDB entry 3pgf

View 3pgf on RCSB PDB site
Description: Crystal structure of maltose bound MBP with a conformationally specific synthetic antigen binder (sAB)
Class: maltodextrin binding protein/de novo protein
Keywords: Maltodextrin binding protein, FAB, antibody fragment, engineered binding protein, MALTODEXTRIN BINDING PROTEIN-DE NOVO PROTEIN complex
Deposited on 2010-11-01, released 2011-03-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: malE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (31-397)
      • engineered mutation (397)
    Domains in SCOPe 2.04: d3pgfa_
  • Chain 'H':
    Compound: SAB Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp686P15220, ighg
    Database cross-references and differences (RAF-indexed):
    • PDB 3PGF (Start-123)
    • Uniprot Q7Z351 (124-End)
  • Chain 'L':
    Compound: SAB Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: igk, IGK@
    Database cross-references and differences (RAF-indexed):
    • PDB 3PGF (Start-106)
    • Uniprot QRTCD0 (107-214)
      • engineered mutation (123)
    Domains in SCOPe 2.04: d3pgfl1, d3pgfl2
  • Heterogens: IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pgfA (A:)
    mkhhhhhhhhhhssdykddddkgenlyfqgskieegklviwingdkgynglaevgkkfek
    dtgikvtvehpdkleekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdkl
    ypftwdavryngkliaypiavealsliynkdllpnppktweeipaldkelkakgksalmf
    nlqepyftwpliaadggyafkyengkydikdvgvdnagakagltflvdliknkhmnadtd
    ysiaeaafnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaa
    spnkelakeflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqkgei
    mpnipqmsafwyavrtavinaasgrqtvdealkdaqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgfA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgkydikdvgvdnagak
    agltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlpt
    fkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksyee
    elakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3pgfL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqssyipvtfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgfL (L:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqssyipvtfgqgtkveikrtvaapsvfifpp
    sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec