PDB entry 3pg3

View 3pg3 on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with RL182
Class: transferase/transferase inhibitor
Keywords: DFG-out, SAR, Kinase domain, Thiazole-urea, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-10-29, released 2011-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered mutation (118)
      • engineered mutation (161)
      • engineered mutation (326)
    Domains in SCOPe 2.06: d3pg3a_
  • Heterogens: BOG, DG7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pg3A (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglcrhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqslesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pg3A (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfgatrwyrapeimln
    wmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesar
    nyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdd
    epvadpydqslesrdllidewksltydevisfvpppl