PDB entry 3pfk

View 3pfk on RCSB PDB site
Description: phosphofructokinase. structure and control
Deposited on 1988-01-25, released 1989-01-09
The last revision prior to the SCOP 1.57 freeze date was dated 1990-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3pfk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pfk_ (-)
    mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
    ihrggtilytarcpefkteegqkkgieqlkkhgiqglvviggdgsyqgakkltehgfpcv
    gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
    glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
    etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
    ankhtidqrmyalskelsi